Lineage for d1dre__ (1dre -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 590993Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 590994Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 590995Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 591015Protein Dihydrofolate reductase, prokaryotic type [53599] (6 species)
  7. 591018Species Escherichia coli [TaxId:562] [53600] (42 PDB entries)
  8. 591077Domain d1dre__: 1dre - [34878]
    complexed with mtx, nap

Details for d1dre__

PDB Entry: 1dre (more details), 2.6 Å

PDB Description: dihydrofolate reductase complexed with methotrexate and nicotinamide adenine dinucleotide phosphate (oxidized form)

SCOP Domain Sequences for d1dre__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dre__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

SCOP Domain Coordinates for d1dre__:

Click to download the PDB-style file with coordinates for d1dre__.
(The format of our PDB-style files is described here.)

Timeline for d1dre__: