SCOP 1.57: Domain d1dre__: 1dre -

Lineage for d1dre__ (1dre -)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)

4. Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)

7. Species Escherichia coli [TaxId:562] [53600] (42 PDB entries)

8. Domain d1dre__: 1dre - [34878]

Details for d1dre__

PDB Entry: 1dre, 2.6 Å

PDB Description: dihydrofolate reductase complexed with methotrexate and nicotinamide adenine dinucleotide phosphate (oxidized form)

SCOP Domain Sequences for d1dre__:

Sequence; same for both SEQRES and ATOM records:

>d1dre__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d1dre__:

• d1dre__ first appeared (with stable ids) in SCOP 1.55
  
• d1dre__ appears in SCOP 1.59
  
• d1dre__ appears in the current release, SCOPe 2.08, called d1drea_