SCOP 1.61: Domain d1rh3__: 1rh3 -

Lineage for d1rh3__ (1rh3 -)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)

4. Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)

7. Species Escherichia coli [TaxId:562] [53600] (42 PDB entries)

8. Domain d1rh3__: 1rh3 - [34877]

Details for d1rh3__

PDB Entry: 1rh3, 2.4 Å

PDB Description: dihydrofolate reductase complexed with methotrexate and nicotinamide adenine dinucleotide phosphate (reduced form)

SCOP Domain Sequences for d1rh3__:

Sequence; same for both SEQRES and ATOM records:

>d1rh3__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d1rh3__:

• d1rh3__ first appeared (with stable ids) in SCOP 1.55
  
• d1rh3__ appears in SCOP 1.59
  
• d1rh3__ appears in SCOP 1.63
  
• d1rh3__ appears in the current release, SCOPe 2.08, called d1rh3a_