SCOPe 2.08: Domain d5y7ia2: 5y7i A:98-242

Lineage for d5y7ia2 (5y7i A:98-242)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Oreochromis mossambicus [TaxId:8127] [348768] (1 PDB entry)

8. Domain d5y7ia2: 5y7i A:98-242 [348769]
   Other proteins in same PDB: d5y7ia1, d5y7ib1
   automated match to d2pera2

Details for d5y7ia2

PDB Entry: 5y7i, 3 Å

PDB Description: structure of tilapia fish clic2

PDB Compounds: (A:) Chloride intracellular channel protein 2

SCOPe Domain Sequences for d5y7ia2:

Sequence; same for both SEQRES and ATOM records:

>d5y7ia2 a.45.1.0 (A:98-242) automated matches {Oreochromis mossambicus [TaxId: 8127]}
ryphlspvnkesfdvgadifakfsafiknspnnplqeknllrefkrlddylnsplpeeid
hnsvetitvsnrkfldgdrltladcnllpklhvirvaakkycnfeipdhftgvwrylkna
derdefkqtcpadieiekaylsvan

Timeline for d5y7ia2:

• d5y7ia2 first appeared in SCOPe 2.07