SCOPe 2.08: Domain d5y7ia1: 5y7i A:9-97

Lineage for d5y7ia1 (5y7i A:9-97)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Oreochromis mossambicus [TaxId:8127] [348766] (1 PDB entry)

8. Domain d5y7ia1: 5y7i A:9-97 [348767]
   Other proteins in same PDB: d5y7ia2, d5y7ib2
   automated match to d2r5ga1

Details for d5y7ia1

PDB Entry: 5y7i, 3 Å

PDB Description: structure of tilapia fish clic2

PDB Compounds: (A:) Chloride intracellular channel protein 2

SCOPe Domain Sequences for d5y7ia1:

Sequence; same for both SEQRES and ATOM records:

>d5y7ia1 c.47.1.0 (A:9-97) automated matches {Oreochromis mossambicus [TaxId: 8127]}
dkepsielfikaghdgenvgncpfcqrlfmvlwlkgvkftvttvdmrkkpaelkdlapgt
nppfllyngtlktdfikieefleqtlapp

Timeline for d5y7ia1:

• d5y7ia1 first appeared in SCOPe 2.07