Lineage for d5xvea_ (5xve A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2497848Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
    Pfam PF00443
  6. 2497901Protein automated matches [191167] (1 species)
    not a true protein
  7. 2497902Species Human (Homo sapiens) [TaxId:9606] [189384] (6 PDB entries)
  8. 3048702Domain d5xvea_: 5xve A: [348764]
    Other proteins in same PDB: d5xveb_
    automated match to d3nhea_
    complexed with zn; mutant

Details for d5xvea_

PDB Entry: 5xve (more details), 1.24 Å

PDB Description: crystal structure of human usp2 c276s mutant in complex with ubiquitin
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 2

SCOPe Domain Sequences for d5xvea_:

Sequence, based on SEQRES records: (download)

>d5xvea_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqglaglrnlgntsfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakli
qtiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpks
npenldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdls
lpiakrgypevtlmdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhl
krfsesrirtsklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytayc
rspgtgewhtfndssvtpmsssqvrtsdayllfyela

Sequence, based on observed residues (ATOM records): (download)

>d5xvea_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqglaglrnlgntsfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakli
qtiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlenld
hlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdlslpiakr
gypevtlmdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhlkrfses
rirtsklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytaycrspgtg
ewhtfndssvtpmsssqvrtsdayllfyela

SCOPe Domain Coordinates for d5xvea_:

Click to download the PDB-style file with coordinates for d5xvea_.
(The format of our PDB-style files is described here.)

Timeline for d5xvea_:

  • d5xvea_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07