Lineage for d5y6qa2 (5y6q A:83-159)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324036Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2324037Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2324144Family a.56.1.0: automated matches [227241] (1 protein)
    not a true family
  6. 2324145Protein automated matches [227007] (6 species)
    not a true protein
  7. 3048682Species Methylobacillus sp. [TaxId:194289] [348744] (1 PDB entry)
  8. 3048683Domain d5y6qa2: 5y6q A:83-159 [348745]
    Other proteins in same PDB: d5y6qa1
    automated match to d1t3qa1
    complexed with fad, fes, gol, ipa, mcn, mos, sf4, so4

Details for d5y6qa2

PDB Entry: 5y6q (more details), 2.5 Å

PDB Description: crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400
PDB Compounds: (A:) Aldehyde oxidase small subunit

SCOPe Domain Sequences for d5y6qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y6qa2 a.56.1.0 (A:83-159) automated matches {Methylobacillus sp. [TaxId: 194289]}
sasgelhpvqrcfvendafqcgyctpgqimsavacikeghagsddeireymsgnlcrcga
yphiidaikqaaaemak

SCOPe Domain Coordinates for d5y6qa2:

Click to download the PDB-style file with coordinates for d5y6qa2.
(The format of our PDB-style files is described here.)

Timeline for d5y6qa2:

  • d5y6qa2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07