Lineage for d5y6qa1 (5y6q A:3-82)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503073Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2503459Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2503460Protein automated matches [191164] (22 species)
    not a true protein
  7. 3048680Species Methylobacillus sp. [TaxId:194289] [348742] (1 PDB entry)
  8. 3048681Domain d5y6qa1: 5y6q A:3-82 [348743]
    Other proteins in same PDB: d5y6qa2
    automated match to d1t3qa2
    complexed with fad, fes, gol, ipa, mcn, mos, sf4, so4

Details for d5y6qa1

PDB Entry: 5y6q (more details), 2.5 Å

PDB Description: crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400
PDB Compounds: (A:) Aldehyde oxidase small subunit

SCOPe Domain Sequences for d5y6qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y6qa1 d.15.4.0 (A:3-82) automated matches {Methylobacillus sp. [TaxId: 194289]}
erisltmqvngqpypmeidprvtlldalrehlnltgtkkgcdqgqcgactvlvngqrvls
cltlaaqadgaevtsieglq

SCOPe Domain Coordinates for d5y6qa1:

Click to download the PDB-style file with coordinates for d5y6qa1.
(The format of our PDB-style files is described here.)

Timeline for d5y6qa1:

  • d5y6qa1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07