![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
![]() | Protein automated matches [191164] (24 species) not a true protein |
![]() | Species Methylobacillus sp. [TaxId:194289] [348742] (1 PDB entry) |
![]() | Domain d5y6qa1: 5y6q A:3-82 [348743] Other proteins in same PDB: d5y6qa2 automated match to d1t3qa2 complexed with fad, fes, gol, ipa, mcn, mos, sf4, so4 |
PDB Entry: 5y6q (more details), 2.5 Å
SCOPe Domain Sequences for d5y6qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y6qa1 d.15.4.0 (A:3-82) automated matches {Methylobacillus sp. [TaxId: 194289]} erisltmqvngqpypmeidprvtlldalrehlnltgtkkgcdqgqcgactvlvngqrvls cltlaaqadgaevtsieglq
Timeline for d5y6qa1: