SCOPe 2.05: Domain d6dfra_: 6dfr A:

Lineage for d6dfra_ (6dfr A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)

7. Species Escherichia coli [TaxId:562] [53600] (74 PDB entries)

8. Domain d6dfra_: 6dfr A: [34874]
   complexed with ca, nap

Details for d6dfra_

PDB Entry: 6dfr, 2.4 Å

PDB Description: crystal structures of escherichia coli dihydrofolate reductase. the nadp+ holoenzyme and the folate(dot)nadp+ ternary complex. substrate binding and a model for the transition state

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d6dfra_:

Sequence, based on SEQRES records:

>d6dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Sequence, based on observed residues (ATOM records):

>d6dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigpwnlpadlawfkrntldkpvimgrhtwesigrplpgrkniilssq
pgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaevegdthf
pdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d6dfra_:

• d6dfra_ first appeared (with stable ids) in SCOP 1.55, called d6dfr__
  
• d6dfra_ appears in SCOPe 2.04
  
• d6dfra_ appears in SCOPe 2.06
  
• d6dfra_ appears in the current release, SCOPe 2.08