Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (125 species) not a true protein |
Species Caldicellulosiruptor owensensis [TaxId:632518] [348704] (1 PDB entry) |
Domain d5y3xc_: 5y3x C: [348725] automated match to d1n82a_ |
PDB Entry: 5y3x (more details), 2.1 Å
SCOPe Domain Sequences for d5y3xc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y3xc_ c.1.8.0 (C:) automated matches {Caldicellulosiruptor owensensis [TaxId: 632518]} ipslaekykeyfkigaavtvkdlegvhgeilvkhfnsltpendmkferihpdehrynfda vdkmkefaiknnmkmrghtfvwhnqtpewvfkdregndvsrellierlrehiktvcdryr divyawdvvneavedktekllrdsnwrriigddyikiafeiakeyagegklfyndynnem pyklektykllkelidketpidgigiqahwniwdknlidnlkraiemyaslgleiqitel dmsvfefedrrtdllepaeemmelqakvyedvfkvfreykgvitsvtfwgisdkhtwkdn fpvigrkdwpllfdvngkpkeaffrivnf
Timeline for d5y3xc_: