Lineage for d5y3xc_ (5y3x C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441152Species Caldicellulosiruptor owensensis [TaxId:632518] [348704] (1 PDB entry)
  8. 2441155Domain d5y3xc_: 5y3x C: [348725]
    automated match to d1n82a_

Details for d5y3xc_

PDB Entry: 5y3x (more details), 2.1 Å

PDB Description: crystal structure of endo-1,4-beta-xylanase from caldicellulosiruptor owensensis
PDB Compounds: (C:) Beta-xylanase

SCOPe Domain Sequences for d5y3xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y3xc_ c.1.8.0 (C:) automated matches {Caldicellulosiruptor owensensis [TaxId: 632518]}
ipslaekykeyfkigaavtvkdlegvhgeilvkhfnsltpendmkferihpdehrynfda
vdkmkefaiknnmkmrghtfvwhnqtpewvfkdregndvsrellierlrehiktvcdryr
divyawdvvneavedktekllrdsnwrriigddyikiafeiakeyagegklfyndynnem
pyklektykllkelidketpidgigiqahwniwdknlidnlkraiemyaslgleiqitel
dmsvfefedrrtdllepaeemmelqakvyedvfkvfreykgvitsvtfwgisdkhtwkdn
fpvigrkdwpllfdvngkpkeaffrivnf

SCOPe Domain Coordinates for d5y3xc_:

Click to download the PDB-style file with coordinates for d5y3xc_.
(The format of our PDB-style files is described here.)

Timeline for d5y3xc_: