![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
![]() | Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) ![]() the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
![]() | Family c.101.1.0: automated matches [191361] (1 protein) not a true family |
![]() | Protein automated matches [190431] (13 species) not a true protein |
![]() | Species Streptomyces sp. [TaxId:1136432] [348491] (5 PDB entries) |
![]() | Domain d5xk3b1: 5xk3 B:1-209 [348721] Other proteins in same PDB: d5xk3a2, d5xk3b2, d5xk3d2 automated match to d5hxpa_ complexed with so4 |
PDB Entry: 5xk3 (more details), 2 Å
SCOPe Domain Sequences for d5xk3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xk3b1 c.101.1.0 (B:1-209) automated matches {Streptomyces sp. [TaxId: 1136432]} mtnlmllpdgmrrwsqkqgislddsyaamtdklveftgwareegfttfyvtvssvanysr seeqvttamnaftevvrrchdtlnfnysgtlevvperwltelealraksdsqsdftlhfi mgmslahevigifnkfngkipalteellaanayvpepvdflirpgghvrmssfyplmspf aemyfcptllndmtradfdvaledlrerd
Timeline for d5xk3b1: