Lineage for d5xu8a_ (5xu8 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2497848Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
    Pfam PF00443
  6. 2497901Protein automated matches [191167] (1 species)
    not a true protein
  7. 2497902Species Human (Homo sapiens) [TaxId:9606] [189384] (6 PDB entries)
  8. 3048630Domain d5xu8a_: 5xu8 A: [348692]
    Other proteins in same PDB: d5xu8b_
    automated match to d3nhea_
    complexed with cl, dx4, na, zn

Details for d5xu8a_

PDB Entry: 5xu8 (more details), 1.81 Å

PDB Description: crystal structure of human usp2 in complex with ubiquitin and 6- thioguanine
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 2

SCOPe Domain Sequences for d5xu8a_:

Sequence, based on SEQRES records: (download)

>d5xu8a_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakliq
tiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpksn
penldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdlsl
piakrgypevtlmdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhlk
rfsesrirtsklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytaycr
spgtgewhtfndssvtpmsssqvrtsdayllfyela

Sequence, based on observed residues (ATOM records): (download)

>d5xu8a_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakliq
tiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvnldhlpd
dekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdlslpiakrgype
vtlmdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhlkrfsesrirt
sklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytaycrspgtgewht
fndssvtpmsssqvrtsdayllfyela

SCOPe Domain Coordinates for d5xu8a_:

Click to download the PDB-style file with coordinates for d5xu8a_.
(The format of our PDB-style files is described here.)

Timeline for d5xu8a_:

  • d5xu8a_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07