Lineage for d1drha_ (1drh A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)
  7. Species Escherichia coli [TaxId:562] [53600] (86 PDB entries)
  8. Domain d1drha_: 1drh A: [34869]
    complexed with nap

Details for d1drha_

PDB Entry: 1drh (more details), 2.3 Å

PDB Description: isomorphous crystal structures of escherichia coli dihydrofolate reductase complexed with folate, 5-deazafolate and 5,10-dideazatetrahydrofolate: mechanistic implications
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1drha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1drha_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

SCOPe Domain Coordinates for d1drha_ are not available.

Timeline for d1drha_: