SCOPe 2.08: Domain d5y3ea2: 5y3e A:63-315

Lineage for d5y3ea2 (5y3e A:63-315)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein automated matches [310868] (6 species)
   not a true protein

7. Species Human sars coronavirus [TaxId:227859] [333837] (3 PDB entries)

8. Domain d5y3ea2: 5y3e A:63-315 [348688]
   Other proteins in same PDB: d5y3ea1, d5y3ea3
   automated match to d2fe8a2
   complexed with gol, na, zn

Details for d5y3ea2

PDB Entry: 5y3e, 1.65 Å

PDB Description: crystal structure of sars coronavirus papain-like protease in complex with glycerol

PDB Compounds: (A:) Replicase polyprotein 1a

SCOPe Domain Sequences for d5y3ea2:

Sequence; same for both SEQRES and ATOM records:

>d5y3ea2 d.3.1.23 (A:63-315) automated matches {Human sars coronavirus [TaxId: 227859]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsyttti

Timeline for d5y3ea2:

• d5y3ea2 first appeared in SCOPe 2.07