Lineage for d5y3ea2 (5y3e A:63-315)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2498013Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
    C-terminal part of Pfam PF08715
  6. 2498033Protein automated matches [310868] (6 species)
    not a true protein
  7. 2498039Species Human sars coronavirus [TaxId:227859] [333837] (3 PDB entries)
  8. 3048626Domain d5y3ea2: 5y3e A:63-315 [348688]
    Other proteins in same PDB: d5y3ea1, d5y3ea3
    automated match to d2fe8a2
    complexed with gol, na, zn

Details for d5y3ea2

PDB Entry: 5y3e (more details), 1.65 Å

PDB Description: crystal structure of sars coronavirus papain-like protease in complex with glycerol
PDB Compounds: (A:) Replicase polyprotein 1a

SCOPe Domain Sequences for d5y3ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y3ea2 d.3.1.23 (A:63-315) automated matches {Human sars coronavirus [TaxId: 227859]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsyttti

SCOPe Domain Coordinates for d5y3ea2:

Click to download the PDB-style file with coordinates for d5y3ea2.
(The format of our PDB-style files is described here.)

Timeline for d5y3ea2:

  • d5y3ea2 is new in SCOPe 2.07-stable