SCOP 1.59: Domain d1tdrb_: 1tdr B:

Lineage for d1tdrb_ (1tdr B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)

4. Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)

7. Species Escherichia coli [TaxId:562] [53600] (42 PDB entries)

8. Domain d1tdrb_: 1tdr B: [34866]

Details for d1tdrb_

PDB Entry: 1tdr, 2.5 Å

PDB Description: expression, characterization, and crystallographic analysis of telluromethionyl dihydrofolate reductase

SCOP Domain Sequences for d1tdrb_:

Sequence; same for both SEQRES and ATOM records:

>d1tdrb_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfkilerr

Timeline for d1tdrb_:

• d1tdrb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tdrb_ appears in SCOP 1.57
  
• d1tdrb_ appears in SCOP 1.61
  
• d1tdrb_ appears in the current release, SCOPe 2.08