SCOPe 2.07: Domain d5xujb1: 5xuj B:449-769

Lineage for d5xujb1 (5xuj B:449-769)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)

8. Domain d5xujb1: 5xuj B:449-769 [348654]
   Other proteins in same PDB: d5xuja2, d5xujb2
   automated match to d4ajmd_
   complexed with 8g6, mg, zn

Details for d5xujb1

PDB Entry: 5xuj, 2.44 Å

PDB Description: crystal structure of pde10a in complex with 7-(4-chlorophenyl)-2- methylpyrazolo[1,5-a]pyrimidine

PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5xujb1:

Sequence; same for both SEQRES and ATOM records:

>d5xujb1 a.211.1.0 (B:449-769) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirge

Timeline for d5xujb1:

• d5xujb1 is new in SCOPe 2.07-stable
  
• d5xujb1 appears in the current release, SCOPe 2.08