Lineage for d5xria1 (5xri A:3-139)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779456Protein automated matches [190029] (6 species)
    not a true protein
  7. 2779464Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries)
  8. 2779489Domain d5xria1: 5xri A:3-139 [348640]
    Other proteins in same PDB: d5xria2
    automated match to d1g86a_
    complexed with gol

Details for d5xria1

PDB Entry: 5xri (more details), 1.68 Å

PDB Description: galectin-10/charcot-leyden crystal protein-c29a crystal structure
PDB Compounds: (A:) Galectin-10

SCOPe Domain Sequences for d5xria1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xria1 b.29.1.3 (A:3-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llpvpyteaaslstgstvtikgrplaaflnepylqvdfhtemkeesdivfhfqvcfgrrv
vmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeavk
mvqvwrdisltkfnvsy

SCOPe Domain Coordinates for d5xria1:

Click to download the PDB-style file with coordinates for d5xria1.
(The format of our PDB-style files is described here.)

Timeline for d5xria1:

  • d5xria1 first appeared in SCOPe 2.07, called d5xria_

View in 3D
Domains from same chain:
(mouse over for more information)
d5xria2