![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
![]() | Protein automated matches [226864] (40 species) not a true protein |
![]() | Species Aspergillus niger [TaxId:5061] [348600] (5 PDB entries) |
![]() | Domain d5xvva1: 5xvv A:3-187 [348638] automated match to d1bvua2 complexed with akg, bme, gol |
PDB Entry: 5xvv (more details), 2.25 Å
SCOPe Domain Sequences for d5xvva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xvva1 c.58.1.0 (A:3-187) automated matches {Aspergillus niger [TaxId: 5061]} nlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnvqv nrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfdpk gksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvltg kggsw
Timeline for d5xvva1: