Lineage for d5xoca_ (5xoc A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387735Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2387736Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2387737Family b.26.1.1: SMAD domain [49880] (5 proteins)
  6. 2387754Protein Smad3 MH2 domain [82030] (1 species)
  7. 2387755Species Human (Homo sapiens) [TaxId:9606] [82031] (4 PDB entries)
    Uniprot P84022 228-425
  8. 2387760Domain d5xoca_: 5xoc A: [348637]
    automated match to d1mk2a_

Details for d5xoca_

PDB Entry: 5xoc (more details), 2.4 Å

PDB Description: crystal structure of human smad3-foxh1 complex
PDB Compounds: (A:) Mothers against decapentaplegic homolog 3

SCOPe Domain Sequences for d5xoca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xoca_ b.26.1.1 (A:) Smad3 MH2 domain {Human (Homo sapiens) [TaxId: 9606]}
lqpvtycepafwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnvnrn
aaveltrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnl
kifnnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhl
ngplqwldkvltqm

SCOPe Domain Coordinates for d5xoca_:

Click to download the PDB-style file with coordinates for d5xoca_.
(The format of our PDB-style files is described here.)

Timeline for d5xoca_: