SCOPe 2.08: Domain d5xm3b_: 5xm3 B:

Lineage for d5xm3b_ (5xm3 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail
   automatically mapped to Pfam PF02315

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)

6. Protein automated matches [190583] (3 species)
   not a true protein

7. Species Methylophaga aminisulfidivorans [TaxId:1026882] [348593] (1 PDB entry)

8. Domain d5xm3b_: 5xm3 B: [348623]
   Other proteins in same PDB: d5xm3a_, d5xm3c_
   automated match to d1w6sb_
   complexed with mg, pqq

Details for d5xm3b_

PDB Entry: 5xm3, 1.7 Å

PDB Description: crystal structure of methanol dehydrogenase from methylophaga aminisulfidivorans

PDB Compounds: (B:) Methanol dehydrogenase [cytochrome c] subunit 2

SCOPe Domain Sequences for d5xm3b_:

Sequence; same for both SEQRES and ATOM records:

>d5xm3b_ a.137.2.1 (B:) automated matches {Methylophaga aminisulfidivorans [TaxId: 1026882]}
ydgtkckaagdcweakpgfpdkikgskydpkhsekelnkqdaalkamekrnaerveqfkk
tgkwvy

Timeline for d5xm3b_:

• d5xm3b_ first appeared in SCOPe 2.07