SCOPe 2.07: Domain d5xuib1: 5xui B:449-769

Lineage for d5xuib1 (5xui B:449-769)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)

8. Domain d5xuib1: 5xui B:449-769 [348614]
   Other proteins in same PDB: d5xuia2, d5xuib2
   automated match to d4ajmd_
   complexed with 8g3, mg, zn

Details for d5xuib1

PDB Entry: 5xui, 2.77 Å

PDB Description: crystal structure of pde10a in complex with 2-methyl-5-[2-([1,2, 4]triazolo[1,5-a]pyrimidin-2-yl)et hyl]pyrazolo[1,5-a]pyrimidin-7-ol

PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5xuib1:

Sequence; same for both SEQRES and ATOM records:

>d5xuib1 a.211.1.0 (B:449-769) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirge

Timeline for d5xuib1:

• d5xuib1 is new in SCOPe 2.07-stable
  
• d5xuib1 appears in the current release, SCOPe 2.08