SCOPe 2.08: Domain d5xdxh_: 5xdx H:

Lineage for d5xdxh_ (5xdx H:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)

6. Protein Cytochrome c oxidase subunit h [47696] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47697] (33 PDB entries)

8. Domain d5xdxh_: 5xdx H: [348612]
   Other proteins in same PDB: d5xdxa_, d5xdxb1, d5xdxb2, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxf_, d5xdxg_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxl_, d5xdxm_, d5xdxn_, d5xdxo1, d5xdxo2, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxs_, d5xdxt_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxy_, d5xdxz_
   automated match to d1v54h_
   complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5xdxh_

PDB Entry: 5xdx, 1.99 Å

PDB Description: bovine heart cytochrome c oxidase in the reduced state with ph 7.3 at 1.99 angstrom resolution

PDB Compounds: (H:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d5xdxh_:

Sequence; same for both SEQRES and ATOM records:

>d5xdxh_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

Timeline for d5xdxh_:

• d5xdxh_ first appeared in SCOPe 2.07