Lineage for d5xvvb1 (5xvv B:2-187)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. Protein automated matches [226864] (38 species)
    not a true protein
  7. Species Aspergillus niger [TaxId:5061] [348600] (5 PDB entries)
  8. Domain d5xvvb1: 5xvv B:2-187 [348608]
    automated match to d1bvua2
    complexed with akg, bme, gol

Details for d5xvvb1

PDB Entry: 5xvv (more details), 2.25 Å

PDB Description: crystal structure of forward inhibited aspergillus niger glutamate dehydrogenase with both apo- and alpha ketoglutarate bound subunits
PDB Compounds: (B:) glutamate dehydrogenase

SCOPe Domain Sequences for d5xvvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xvvb1 c.58.1.0 (B:2-187) automated matches {Aspergillus niger [TaxId: 5061]}
snlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnvq
vnrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfdp
kgksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvlt
gkggsw

SCOPe Domain Coordinates for d5xvvb1 are not available.

Timeline for d5xvvb1:

Domains from other chains:
(mouse over for more information)
d5xvva1, d5xvvc1, d5xvvd1, d5xvve1, d5xvvf1