Lineage for d5xvve1 (5xvv E:3-187)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890638Species Aspergillus niger [TaxId:5061] [348600] (5 PDB entries)
  8. 2890646Domain d5xvve1: 5xvv E:3-187 [348601]
    automated match to d1bvua2
    complexed with akg, bme, gol

Details for d5xvve1

PDB Entry: 5xvv (more details), 2.25 Å

PDB Description: crystal structure of forward inhibited aspergillus niger glutamate dehydrogenase with both apo- and alpha ketoglutarate bound subunits
PDB Compounds: (E:) glutamate dehydrogenase

SCOPe Domain Sequences for d5xvve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xvve1 c.58.1.0 (E:3-187) automated matches {Aspergillus niger [TaxId: 5061]}
nlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnvqv
nrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfdpk
gksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvltg
kggsw

SCOPe Domain Coordinates for d5xvve1:

Click to download the PDB-style file with coordinates for d5xvve1.
(The format of our PDB-style files is described here.)

Timeline for d5xvve1: