| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
| Protein automated matches [190029] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries) |
| Domain d5xrla1: 5xrl A:3-141 [348596] Other proteins in same PDB: d5xrla2 automated match to d1g86a_ complexed with gol |
PDB Entry: 5xrl (more details), 2 Å
SCOPe Domain Sequences for d5xrla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xrla1 b.29.1.3 (A:3-141) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcfgrrv
vmasreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeavk
mvqvwrdisltkfnvsylk
Timeline for d5xrla1: