SCOPe 2.08: Domain d5xrla1: 5xrl A:3-141

Lineage for d5xrla1 (5xrl A:3-141)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein automated matches [190029] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries)

8. Domain d5xrla1: 5xrl A:3-141 [348596]
   Other proteins in same PDB: d5xrla2
   automated match to d1g86a_
   complexed with gol

Details for d5xrla1

PDB Entry: 5xrl, 2 Å

PDB Description: galectin-10/charcot-leyden crystal protein variant n65a crystal structure

PDB Compounds: (A:) Galectin-10

SCOPe Domain Sequences for d5xrla1:

Sequence; same for both SEQRES and ATOM records:

>d5xrla1 b.29.1.3 (A:3-141) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llpvpyteaaslstgstvtikgrplacflnepylqvdfhtemkeesdivfhfqvcfgrrv
vmasreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeavk
mvqvwrdisltkfnvsylk

Timeline for d5xrla1:

• d5xrla1 first appeared in SCOPe 2.07, called d5xrla_