Lineage for d5x5xl1 (5x5x L:0-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744471Domain d5x5xl1: 5x5x L:0-108 [348534]
    Other proteins in same PDB: d5x5xl2
    automated match to d1mrel1
    complexed with fmt, peg, pg4, pge

Details for d5x5xl1

PDB Entry: 5x5x (more details), 1.9 Å

PDB Description: crystal structure of the fab fragment of anti-osteocalcin c-terminal peptide antibody ktm219
PDB Compounds: (L:) L chain of anti-osteocalcin antibody KTM219

SCOPe Domain Sequences for d5x5xl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x5xl1 b.1.1.1 (L:0-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sdieltqsplslpvslgdqasisctssqsllhsngdtylhwylqkpgqspklliytlsnr
fsgvpdrfsgsgsgtdftlkisrveaadlgiyfcsqtthvpytfgggtkleikr

SCOPe Domain Coordinates for d5x5xl1:

Click to download the PDB-style file with coordinates for d5x5xl1.
(The format of our PDB-style files is described here.)

Timeline for d5x5xl1: