Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (58 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255624] (13 PDB entries) |
Domain d5xb1d_: 5xb1 D: [348528] automated match to d3hx7b_ mutant |
PDB Entry: 5xb1 (more details), 3 Å
SCOPe Domain Sequences for d5xb1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xb1d_ a.25.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere haeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdk ndphlcdfiethylneqvkaikelgdhvtnlrkmg
Timeline for d5xb1d_: