Lineage for d1rg7a_ (1rg7 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1871771Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1871800Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)
  7. 1871811Species Escherichia coli [TaxId:562] [53600] (74 PDB entries)
  8. 1871873Domain d1rg7a_: 1rg7 A: [34852]
    complexed with mtx

Details for d1rg7a_

PDB Entry: 1rg7 (more details), 2 Å

PDB Description: dihydrofolate reductase complexed with methotrexate
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1rg7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rg7a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

SCOPe Domain Coordinates for d1rg7a_:

Click to download the PDB-style file with coordinates for d1rg7a_.
(The format of our PDB-style files is described here.)

Timeline for d1rg7a_: