Lineage for d5x32b_ (5x32 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722309Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2722310Protein automated matches [190108] (23 species)
    not a true protein
  7. 2722343Species Marinomonas mediterranea [TaxId:717774] [348507] (1 PDB entry)
  8. 2722345Domain d5x32b_: 5x32 B: [348511]
    automated match to d2gz6b_
    complexed with po4

Details for d5x32b_

PDB Entry: 5x32 (more details), 2.59 Å

PDB Description: crystal structure of d-mannose isomerase
PDB Compounds: (B:) N-acylglucosamine 2-epimerase

SCOPe Domain Sequences for d5x32b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x32b_ a.102.1.0 (B:) automated matches {Marinomonas mediterranea [TaxId: 717774]}
sypafdsktfleahiektmafyfptcidpeggffqffkddgsvydpntrhlvsstrfifn
faqaylhtniaeykhaavhgiqylrqrhqsqsggyvwlldggtnldetnhcyglafvila
ysnalqiglseaevwievtydllethfwenkhglyldeissdwktvspyrgqnanmhmce
almsafdatqnpkyldrakllaknicqkqaslsnsnevwehytndwqidwdynkndpkhl
frpwgfqpghqtewaklllmldkrspenwylpkakylfdlaykkawdtkkgglhygyapd
gtvcdpdkyfwvqaesfaaawllykatkdetyykqyltlwefswnhmidhtfgawyrild
ennaqydnnkspagktdyhtmgacyevlktl

SCOPe Domain Coordinates for d5x32b_:

Click to download the PDB-style file with coordinates for d5x32b_.
(The format of our PDB-style files is described here.)

Timeline for d5x32b_: