Lineage for d5xage_ (5xag E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339704Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2339705Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2339706Protein Stathmin 4 [101496] (2 species)
  7. 2339707Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (97 PDB entries)
  8. 3048428Domain d5xage_: 5xag E: [348490]
    Other proteins in same PDB: d5xaga1, d5xaga2, d5xagb1, d5xagb2, d5xagc1, d5xagc2, d5xagd1, d5xagd2, d5xagf1
    automated match to d4i55e_
    complexed with 93x, acp, ca, gdp, gol, gtp, imd, mes, mg

Details for d5xage_

PDB Entry: 5xag (more details), 2.56 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound z2 complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5xage_:

Sequence, based on SEQRES records: (download)

>d5xage_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelk

Sequence, based on observed residues (ATOM records): (download)

>d5xage_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk

SCOPe Domain Coordinates for d5xage_:

Click to download the PDB-style file with coordinates for d5xage_.
(The format of our PDB-style files is described here.)

Timeline for d5xage_:

  • d5xage_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07