Lineage for d2drcb_ (2drc B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74023Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
  4. 74024Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 74025Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 74029Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)
  7. 74030Species Escherichia coli [TaxId:562] [53600] (42 PDB entries)
  8. 74060Domain d2drcb_: 2drc B: [34849]

Details for d2drcb_

PDB Entry: 2drc (more details), 1.9 Å

PDB Description: investigation of the functional role of tryptophan-22 in escherichia coli dihydrofolate reductase by site-directed mutagenesis

SCOP Domain Sequences for d2drcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2drcb_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampfnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

SCOP Domain Coordinates for d2drcb_:

Click to download the PDB-style file with coordinates for d2drcb_.
(The format of our PDB-style files is described here.)

Timeline for d2drcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2drca_