SCOPe 2.07: Domain d5xaga1: 5xag A:1-245

Lineage for d5xaga1 (5xag A:1-245)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (61 PDB entries)

8. Domain d5xaga1: 5xag A:1-245 [348484]
   Other proteins in same PDB: d5xaga2, d5xagb2, d5xagc2, d5xagd2, d5xage_, d5xagf1
   automated match to d5fnva1
   complexed with 93x, acp, ca, gdp, gol, gtp, imd, mes, mg

Details for d5xaga1

PDB Entry: 5xag, 2.56 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound z2 complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5xaga1:

Sequence; same for both SEQRES and ATOM records:

>d5xaga1 c.32.1.1 (A:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d5xaga1:

• d5xaga1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07