Lineage for d5xagd2 (5xag D:246-441)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525736Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries)
  8. 3048405Domain d5xagd2: 5xag D:246-441 [348467]
    Other proteins in same PDB: d5xaga1, d5xagb1, d5xagc1, d5xagd1, d5xage_, d5xagf1
    automated match to d3rycd2
    complexed with 93x, acp, ca, gdp, gol, gtp, imd, mes, mg

Details for d5xagd2

PDB Entry: 5xag (more details), 2.56 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound z2 complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5xagd2:

Sequence, based on SEQRES records: (download)

>d5xagd2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d5xagd2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv
aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

SCOPe Domain Coordinates for d5xagd2:

Click to download the PDB-style file with coordinates for d5xagd2.
(The format of our PDB-style files is described here.)

Timeline for d5xagd2:

  • d5xagd2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06