Lineage for d5xagd1 (5xag D:1-245)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445493Species Sheep (Ovis aries) [TaxId:9940] [224884] (15 PDB entries)
  8. 3048404Domain d5xagd1: 5xag D:1-245 [348466]
    Other proteins in same PDB: d5xaga2, d5xagb2, d5xagc2, d5xagd2, d5xage_, d5xagf1
    automated match to d4drxb1
    complexed with 93x, acp, ca, gdp, gol, gtp, imd, mes, mg

Details for d5xagd1

PDB Entry: 5xag (more details), 2.56 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound z2 complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5xagd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xagd1 c.32.1.1 (D:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d5xagd1:

Click to download the PDB-style file with coordinates for d5xagd1.
(The format of our PDB-style files is described here.)

Timeline for d5xagd1:

  • d5xagd1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06