Lineage for d5xagf1 (5xag F:1-76)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2444095Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2444096Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2444379Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2444380Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2444381Species Chicken (Gallus gallus) [TaxId:9031] [311384] (82 PDB entries)
  8. 3048390Domain d5xagf1: 5xag F:1-76 [348452]
    Other proteins in same PDB: d5xaga1, d5xaga2, d5xagb1, d5xagb2, d5xagc1, d5xagc2, d5xagd1, d5xagd2, d5xage_
    automated match to d3tiia1
    complexed with 93x, acp, ca, gdp, gol, gtp, imd, mes, mg

Details for d5xagf1

PDB Entry: 5xag (more details), 2.56 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound z2 complex
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d5xagf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xagf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5xagf1:

Click to download the PDB-style file with coordinates for d5xagf1.
(The format of our PDB-style files is described here.)

Timeline for d5xagf1:

  • d5xagf1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06