Lineage for d5xc9a1 (5xc9 A:1-178)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2393919Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2393920Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families) (S)
  5. 2393971Family b.52.1.0: automated matches [227180] (1 protein)
    not a true family
  6. 2393972Protein automated matches [226899] (4 species)
    not a true protein
  7. 3048382Species Ampullaria crossean [TaxId:228791] [348444] (6 PDB entries)
  8. 3048383Domain d5xc9a1: 5xc9 A:1-178 [348445]
    Other proteins in same PDB: d5xc9a2
    automated match to d1wc2a1
    complexed with cbi

Details for d5xc9a1

PDB Entry: 5xc9 (more details), 1.28 Å

PDB Description: crystal structure of gh45 endoglucanase eg27ii at ph8.0, in complex with cellobiose
PDB Compounds: (A:) endo-beta-1,4-glucanase

SCOPe Domain Sequences for d5xc9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xc9a1 b.52.1.0 (A:1-178) automated matches {Ampullaria crossean [TaxId: 228791]}
aqlcqpdahgvrrfngrpcasttryvdghkgacgcgqkgsdtpfpwnlqkhvtapseryf
ddggsnlwcgkncgkcvrltptggfvpgkggappnhnpvvfmvtnacpingneewcgisg
kpgtnhvnshgyevhfdlqdqvgqvealhwdnpevtweevpcpgdlqanyqqcechns

SCOPe Domain Coordinates for d5xc9a1:

Click to download the PDB-style file with coordinates for d5xc9a1.
(The format of our PDB-style files is described here.)

Timeline for d5xc9a1:

  • d5xc9a1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5xc9a2