Lineage for d5x45a_ (5x45 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797935Protein automated matches [190384] (21 species)
    not a true protein
  7. 2798132Species Rhinovirus c [TaxId:463676] [255484] (2 PDB entries)
  8. 2798133Domain d5x45a_: 5x45 A: [348434]
    automated match to d2m5ta_
    complexed with zn

Details for d5x45a_

PDB Entry: 5x45 (more details), 2.6 Å

PDB Description: crystal structure of 2a protease from human rhinovirus c15
PDB Compounds: (A:) Protease 2A

SCOPe Domain Sequences for d5x45a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x45a_ b.47.1.4 (A:) automated matches {Rhinovirus c [TaxId: 463676]}
gpsdmfvhtrdaiykcahltnptdetillaltadlqvdstnvpgpdvipccdctagcyys
rskdryfpvecvshdwyeiqesgyypkhiqynlligeghcepgdcggkllckhgvigmit
aggdnhvaftdlrpys

SCOPe Domain Coordinates for d5x45a_:

Click to download the PDB-style file with coordinates for d5x45a_.
(The format of our PDB-style files is described here.)

Timeline for d5x45a_: