SCOP 1.61: Domain d1dyha_: 1dyh A:

Lineage for d1dyha_ (1dyh A:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)

4. Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)

7. Species Escherichia coli [TaxId:562] [53600] (42 PDB entries)

8. Domain d1dyha_: 1dyh A: [34842]

Details for d1dyha_

PDB Entry: 1dyh, 1.9 Å

PDB Description: isomorphous crystal structures of escherichia coli dihydrofolate reductase complexed with folate, 5-deazafolate and 5,10-dideazatetrahydrofolate: mechanistic implications

SCOP Domain Sequences for d1dyha_:

Sequence; same for both SEQRES and ATOM records:

>d1dyha_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d1dyha_:

• d1dyha_ first appeared (with stable ids) in SCOP 1.55
  
• d1dyha_ appears in SCOP 1.59
  
• d1dyha_ appears in SCOP 1.63
  
• d1dyha_ appears in the current release, SCOPe 2.08