Lineage for d5x9la_ (5x9l A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. Protein Thaumatin [49876] (1 species)
  7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (112 PDB entries)
    Uniprot P02883
  8. Domain d5x9la_: 5x9l A: [348413]
    automated match to d1thva_
    complexed with gol, tla

Details for d5x9la_

PDB Entry: 5x9l (more details), 0.9 Å

PDB Description: recombinant thaumatin i at 0.9 angstrom
PDB Compounds: (A:) thaumatin I

SCOPe Domain Sequences for d5x9la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x9la_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d5x9la_ are not available.

Timeline for d5x9la_: