Lineage for d5xakb_ (5xak B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. Protein automated matches [190123] (156 species)
    not a true protein
  7. Species Thermus thermophilus [TaxId:300852] [272710] (21 PDB entries)
  8. Domain d5xakb_: 5xak B: [348399]
    automated match to d3n2ia_
    complexed with cl, cs

Details for d5xakb_

PDB Entry: 5xak (more details), 1.5 Å

PDB Description: crystal structure (form ii) of thymidylate kinase from thermus thermophilus hb8
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d5xakb_:

Sequence, based on SEQRES records: (download)

>d5xakb_ c.37.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 300852]}
glfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeaey
llfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrgl
kprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatlpe
eeiaraiqahlrpll

Sequence, based on observed residues (ATOM records): (download)

>d5xakb_ c.37.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 300852]}
glfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeaey
llfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrgl
kprltflldlppeaaglgleffrrvregylalaraepgrfvvldatlpeeeiaraiqahl
rpll

SCOPe Domain Coordinates for d5xakb_ are not available.

Timeline for d5xakb_:

Domains from other chains:
(mouse over for more information)
d5xaka_