Lineage for d5x8vb_ (5x8v B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2481071Species Thermus thermophilus [TaxId:300852] [272710] (20 PDB entries)
  8. 2481081Domain d5x8vb_: 5x8v B: [348390]
    automated match to d3n2ia_
    complexed with cl, na; mutant

Details for d5x8vb_

PDB Entry: 5x8v (more details), 1.66 Å

PDB Description: y92h mutant of thermus thermophilus hb8 thymidylate kinase
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d5x8vb_:

Sequence, based on SEQRES records: (download)

>d5x8vb_ c.37.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 300852]}
pglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae
yllfsadraehvrkvilpglaagkvvisdrhldsslayqgygrglplpwlrevareatrg
lkprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatlp
eeeiaraiqahlrpllp

Sequence, based on observed residues (ATOM records): (download)

>d5x8vb_ c.37.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 300852]}
pglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae
yllfsadraehvrkvilpglaagkvvisdrhldsslayqgygrglplpwlrevareatrg
lkprltflldlppeaagleffrrvregylalaraepgrfvvldatlpeeeiaraiqahlr
pllp

SCOPe Domain Coordinates for d5x8vb_:

Click to download the PDB-style file with coordinates for d5x8vb_.
(The format of our PDB-style files is described here.)

Timeline for d5x8vb_: