Lineage for d1jom__ (1jom -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) 
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species) Species Escherichia coli [TaxId:562] [53600] (42 PDB entries) 
Domain d1jom__: 1jom - [34839]
Details for d1jom__
PDB Entry: 1jom (more details), 1.9 Å
PDB Description: the crystal structure of the binary complex between folinic acid (leucovorin) and e. coli dihydrofolate reductase
SCOP Domain Sequences for d1jom__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jom__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
SCOP Domain Coordinates for d1jom__:
Click to download the PDB-style file with coordinates for d1jom__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jom__:
- d1jom__ appears in SCOP 1.57
- d1jom__ appears in the current release, SCOPe 2.08, called d1joma_
View in 3D