Lineage for d1dyib_ (1dyi B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2153717Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2153746Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)
  7. 2153757Species Escherichia coli [TaxId:562] [53600] (79 PDB entries)
  8. 2153793Domain d1dyib_: 1dyi B: [34838]
    complexed with ca, cl, fol

Details for d1dyib_

PDB Entry: 1dyi (more details), 1.9 Å

PDB Description: isomorphous crystal structures of escherichia coli dihydrofolate reductase complexed with folate, 5-deazafolate and 5,10-dideazatetrahydrofolate: mechanistic implications
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d1dyib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyib_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

SCOPe Domain Coordinates for d1dyib_:

Click to download the PDB-style file with coordinates for d1dyib_.
(The format of our PDB-style files is described here.)

Timeline for d1dyib_: