Lineage for d5x7lb1 (5x7l B:2-134)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. Protein automated matches [190205] (34 species)
    not a true protein
  7. Species Streptomyces laurentii [TaxId:39478] [348357] (1 PDB entry)
  8. Domain d5x7lb1: 5x7l B:2-134 [348377]
    Other proteins in same PDB: d5x7la2, d5x7lb2
    automated match to d2geyb_
    complexed with ipa

Details for d5x7lb1

PDB Entry: 5x7l (more details), 1.22 Å

PDB Description: structure of tsrd from streptomyces laurentii
PDB Compounds: (B:) TsrD

SCOPe Domain Sequences for d5x7lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x7lb1 d.17.4.0 (B:2-134) automated matches {Streptomyces laurentii [TaxId: 39478]}
drasvqqlmehflaaynegdprhldhclhpeyrhpnpavergiegmraairrwastvedl
sltlddlvvegdkavarmtfsgrqvgpilgipasgrrfsvglidifliedglfaqhwdem
dllglhrqlgalp

SCOPe Domain Coordinates for d5x7lb1 are not available.

Timeline for d5x7lb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5x7lb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5x7la1, d5x7la2