SCOPe 2.08: Domain d5x7lb1: 5x7l B:2-134

Lineage for d5x7lb1 (5x7l B:2-134)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (35 species)
   not a true protein

7. Species Streptomyces laurentii [TaxId:39478] [348357] (1 PDB entry)

8. Domain d5x7lb1: 5x7l B:2-134 [348377]
   Other proteins in same PDB: d5x7la2, d5x7lb2
   automated match to d2geyb_
   complexed with ipa

Details for d5x7lb1

PDB Entry: 5x7l, 1.22 Å

PDB Description: structure of tsrd from streptomyces laurentii

PDB Compounds: (B:) TsrD

SCOPe Domain Sequences for d5x7lb1:

Sequence; same for both SEQRES and ATOM records:

>d5x7lb1 d.17.4.0 (B:2-134) automated matches {Streptomyces laurentii [TaxId: 39478]}
drasvqqlmehflaaynegdprhldhclhpeyrhpnpavergiegmraairrwastvedl
sltlddlvvegdkavarmtfsgrqvgpilgipasgrrfsvglidifliedglfaqhwdem
dllglhrqlgalp

Timeline for d5x7lb1:

• d5x7lb1 first appeared in SCOPe 2.07