SCOPe 2.08: Domain d5x6kb_: 5x6k B:

Lineage for d5x6kb_ (5x6k B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Black rockcod (Notothenia coriiceps) [TaxId:8208] [348353] (2 PDB entries)

8. Domain d5x6kb_: 5x6k B: [348373]
   automated match to d2bwja_
   complexed with ap5, so4

Details for d5x6kb_

PDB Entry: 5x6k, 1.99 Å

PDB Description: crystal structure of adenylate kinase

PDB Compounds: (B:) adenylate kinase isoenzyme 1

SCOPe Domain Sequences for d5x6kb_:

Sequence; same for both SEQRES and ATOM records:

>d5x6kb_ c.37.1.0 (B:) automated matches {Black rockcod (Notothenia coriiceps) [TaxId: 8208]}
kiifvvggpgsgkgtqcekvvakygythlssgdllraevssgsergkqlqaimqkgelvp
ldtvldmikdamiakadvskgylidgyprevkqgeefekkigkpclllyvdakgetmvkr
lmkrgetsgraddneetikkrldlyykatepviafyegrgivrkvdselpvdevfkqvst
aidal

Timeline for d5x6kb_:

• d5x6kb_ first appeared in SCOPe 2.07