SCOPe 2.08: Domain d5x00a1: 5x00 A:1-142

Lineage for d5x00a1 (5x00 A:1-142)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.0: automated matches [191597] (1 protein)
   not a true family

6. Protein automated matches [191087] (19 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:579112] [348362] (1 PDB entry)

8. Domain d5x00a1: 5x00 A:1-142 [348363]
   Other proteins in same PDB: d5x00a2
   automated match to d5yola_

Details for d5x00a1

PDB Entry: 5x00, 3.06 Å

PDB Description: nucleoside diphosphate kinase from vibrio cholerae is a thermolabile type ii tetramer

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5x00a1:

Sequence, based on SEQRES records:

>d5x00a1 d.58.6.0 (A:1-142) automated matches {Vibrio cholerae [TaxId: 579112]}
malertfsiikpdavkrnligeiyhriekaglqiiaakmvhlseeqasgfyaehegkpff
eplkefmtsgpimvqvlegenaiaryrelmgktnpeeaacgtlradyalsmrynsvhgsd
spasaareiefffpeseicprp

Sequence, based on observed residues (ATOM records):

>d5x00a1 d.58.6.0 (A:1-142) automated matches {Vibrio cholerae [TaxId: 579112]}
malertfsiikpdavkrnligeiyhriekaglqiiaakmvhlseeqasgfyaehegkpff
eplkefmtsgpimvqvlegenaiaryrelmgkrynsvhgsdspasaareiefffpeseic
prp

Timeline for d5x00a1:

• d5x00a1 first appeared in SCOPe 2.07