Lineage for d5x7la1 (5x7l A:2-133)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2544255Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2544256Protein automated matches [190205] (33 species)
    not a true protein
  7. 2544419Species Streptomyces laurentii [TaxId:39478] [348357] (1 PDB entry)
  8. 2544420Domain d5x7la1: 5x7l A:2-133 [348358]
    Other proteins in same PDB: d5x7la2, d5x7lb2
    automated match to d2geyb_
    complexed with ipa

Details for d5x7la1

PDB Entry: 5x7l (more details), 1.22 Å

PDB Description: structure of tsrd from streptomyces laurentii
PDB Compounds: (A:) TsrD

SCOPe Domain Sequences for d5x7la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x7la1 d.17.4.0 (A:2-133) automated matches {Streptomyces laurentii [TaxId: 39478]}
drasvqqlmehflaaynegdprhldhclhpeyrhpnpavergiegmraairrwastvedl
sltlddlvvegdkavarmtfsgrqvgpilgipasgrrfsvglidifliedglfaqhwdem
dllglhrqlgal

SCOPe Domain Coordinates for d5x7la1:

Click to download the PDB-style file with coordinates for d5x7la1.
(The format of our PDB-style files is described here.)

Timeline for d5x7la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5x7la2