SCOPe 2.08: Domain d5vyfa2: 5vyf A:107-211

Lineage for d5vyfa2 (5vyf A:107-211)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d5vyfa2: 5vyf A:107-211 [348352]
Other proteins in same PDB: d5vyfa1, d5vyfb_, d5vyfc1, d5vyfc2, d5vyff1, d5vyff2, d5vyfh_, d5vyfl1
automated match to d1dn0a2
complexed with ca

Details for d5vyfa2

PDB Entry: 5vyf (more details), 2.9 Å

PDB Description: structure of single chain fel d 1 bound to a neutralizing antibody

PDB Compounds: (A:) Antibody Light Chain

SCOPe Domain Sequences for d5vyfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vyfa2 b.1.1.2 (A:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d5vyfa2:

Click to download the PDB-style file with coordinates for d5vyfa2.
(The format of our PDB-style files is described here.)

Timeline for d5vyfa2: