SCOPe 2.08: Domain d5vyfa1: 5vyf A:1-106

Lineage for d5vyfa1 (5vyf A:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5vyfa1: 5vyf A:1-106 [348351]
   Other proteins in same PDB: d5vyfa2, d5vyfb_, d5vyfc1, d5vyfc2, d5vyff1, d5vyff2, d5vyfh_, d5vyfl2
   automated match to d1dn0a1
   complexed with ca

Details for d5vyfa1

PDB Entry: 5vyf, 2.9 Å

PDB Description: structure of single chain fel d 1 bound to a neutralizing antibody

PDB Compounds: (A:) Antibody Light Chain

SCOPe Domain Sequences for d5vyfa1:

Sequence; same for both SEQRES and ATOM records:

>d5vyfa1 b.1.1.0 (A:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspstlsasvgdrvtitcrasqsisswlawyqqkpgkapklliykasslesgvps
rfsgsgsgtdftltisslrpedfatyycqqynsypltfgggtkvei

Timeline for d5vyfa1:

• d5vyfa1 first appeared in SCOPe 2.07