Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d5vyfa1: 5vyf A:1-106 [348351] Other proteins in same PDB: d5vyfa2, d5vyfb_, d5vyfc1, d5vyfc2, d5vyff1, d5vyff2, d5vyfh_, d5vyfl2 automated match to d1dn0a1 complexed with ca |
PDB Entry: 5vyf (more details), 2.9 Å
SCOPe Domain Sequences for d5vyfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vyfa1 b.1.1.0 (A:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]} diqmtqspstlsasvgdrvtitcrasqsisswlawyqqkpgkapklliykasslesgvps rfsgsgsgtdftltisslrpedfatyycqqynsypltfgggtkvei
Timeline for d5vyfa1: