SCOPe 2.07: Domain d5vztc1: 5vzt C:1002-1069

Lineage for d5vztc1 (5vzt C:1002-1069)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries)

8. Domain d5vztc1: 5vzt C:1002-1069 [348349]
   Other proteins in same PDB: d5vzta2, d5vztc2
   automated match to d3wsob1
   complexed with dtt, po4, zn

Details for d5vztc1

PDB Entry: 5vzt, 2.7 Å

PDB Description: crystal structure of the skp1-fbxo31 complex

PDB Compounds: (C:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d5vztc1:

Sequence; same for both SEQRES and ATOM records:

>d5vztc1 d.42.1.0 (C:1002-1069) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
dp

Timeline for d5vztc1:

• d5vztc1 is new in SCOPe 2.07-stable
  
• d5vztc1 appears in the current release, SCOPe 2.08